Homolog Find
A homology inferring function allows users to quickly obtain the optimal homologous gene set for the genes of interest, which is more robust than a simple sequence BLAST search and could be used for quick specific gene clade contraction-or-expansion analysis.
Input file format
In the "Homolog Find" module, users can quickly identify homologous genes in Sapindaceae species for any given Arabidopsis, rice gene, or input gene sequence. There are two supported input modes: Mode 1, directly input the gene ID of Arabidopsis or rice, the program will automatically obtain the related sequence and identify homologous genes; Mode 2, input the protein sequence.
Example of Mode 1:
Arabidopsis ID
AT4G18960Rice ID
LOC_Os02g41510Example of Mode 2:
input protein sequence
MADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCN
QLSPQVEHRPFSAEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWN
STLKRKCGGYDHRGYDGSEDHRPVKRSVSAGSPPVVTGLYMSPGSPTGSD
VSDSSTIPILPSVELFKPVPRPGAVVLPLPIETSSSSDDPPTSLSLSLPG
ADVSEESNRSHESTNINNTTSSRHNHNNTVSFMPFSGGFRGAIEEMGKSF
PGNGGEFMAVVQEMIKAEVRSYMTEMQRNNGGGFVGGFIDNGMIPMSQIG
VGRIEOutput file format
The identification results are displayed in an evolutionary tree, with the best homologous genes highlighted in red and the query genes highlighted in yellow. Detailed information on the identified homologous genes is presented below in a table. Click the download link can download the evolutionary tree diagram.

Demo:

Last updated
Was this helpful?